DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and exos-3

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_492751.1 Gene:exos-3 / 186604 WormBaseID:WBGene00010325 Length:226 Species:Caenorhabditis elegans


Alignment Length:207 Identity:76/207 - (36%)
Similarity:122/207 - (58%) Gaps:4/207 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TIVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGD 70
            |:.:||:   .|.|.:.|...|:|.|:.....|.:|::.|.. |.:.|..|::.:.:||||..||
 Worm     2 TVYLPGD---VINEPSSSDSSIIGYGISVRGQTRIATQPGAF-HNDDGKVWLNVHSKRYIPQEGD 62

  Fly    71 LILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYARVLNASADIEPELVC 135
            .::.||.:|.||.:|:|||..:.|.|::..||.|:|:|||:|..||:|||.|.:.:...|.||.|
 Worm    63 RVIAIVTSKTGDFFRLDIGTAEYAMINFTNFEGATKRNRPNLKTGDIIYATVFDTTPRTEAELTC 127

  Fly   136 VNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTRELPYEIAVGVNGRIWLKAHSLKE 200
            |:...::..:|.|..||.||.|||..|.|:..:|.:|..:.:...:||.||:|||||:.|.:..:
 Worm   128 VDDEKRARGMGQLNGGFMFKVSLNHCRRLINPSCKILQTVGKFFKFEITVGMNGRIWISASTSDD 192

  Fly   201 TVALANAISALE 212
            .:.:.:.|:..|
 Worm   193 IIKIHDIINKSE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 76/207 (37%)
S1_Rrp40 63..148 CDD:240216 37/84 (44%)
exos-3NP_492751.1 Rrp4 5..>187 CDD:224022 72/185 (39%)
S1_Rrp40 55..140 CDD:240216 37/84 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162239
Domainoid 1 1.000 103 1.000 Domainoid score I4280
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6867
Inparanoid 1 1.050 149 1.000 Inparanoid score I2981
Isobase 1 0.950 - 0.878984 Normalized mean entropy S1604
OMA 1 1.010 - - QHG54235
OrthoDB 1 1.010 - - D1284731at2759
OrthoFinder 1 1.000 - - FOG0004390
OrthoInspector 1 1.000 - - oto19177
orthoMCL 1 0.900 - - OOG6_102463
Panther 1 1.100 - - LDO PTHR21321
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2268
SonicParanoid 1 1.000 - - X3108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.