DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and exos-2

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_500978.1 Gene:exos-2 / 177403 WormBaseID:WBGene00022232 Length:303 Species:Caenorhabditis elegans


Alignment Length:240 Identity:57/240 - (23%)
Similarity:83/240 - (34%) Gaps:77/240 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGDL 71
            ||:||..:....:     :.:.|.|....|..:|:|.:|.::... ....|...::||....||:
 Worm    31 IVIPGHSVCDAPQ-----QFMRGHGTYVRDGEIVSSLSGVVQQLN-RLLMVKTIKQRYAGEVGDV 89

  Fly    72 I-------------------------LGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPD 111
            :                         ||.|....||..|.|:...:..| .:|       ||   
 Worm    90 VVARVVEVQAKRWKCDVASRLHANLPLGSVLLPGGDFRRKDVEDEEKMS-EFL-------KN--- 143

  Fly   112 LIPGDLIYARVLNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALT 176
               |:||.|.|.....|....|...|:     |.|.|..|...|..            |.|...:
 Worm   144 ---GELICAEVQQVQHDGTLMLHTRNN-----KYGKLQQGILIKVP------------PHLIKKS 188

  Fly   177 RE----LPYEIAV--GVNGRIWLKAHSLKETVALANAISALEQSG 215
            ::    |||.:||  |.||.:|: ..||.||        .||:.|
 Worm   189 KKHFHTLPYGMAVIIGCNGSVWV-TPSLPET--------TLEEDG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 55/236 (23%)
S1_Rrp40 63..148 CDD:240216 25/109 (23%)
exos-2NP_500978.1 ECR1_N 31..68 CDD:291080 10/41 (24%)
S1_Rrp4 81..172 CDD:240215 25/109 (23%)
KH_6 175..214 CDD:292607 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.