DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lst8 and AT5G50650

DIOPT Version :9

Sequence 1:NP_572572.1 Gene:Lst8 / 31903 FlyBaseID:FBgn0264691 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_680414.1 Gene:AT5G50650 / 835135 AraportID:AT5G50650 Length:383 Species:Arabidopsis thaliana


Alignment Length:256 Identity:59/256 - (23%)
Similarity:90/256 - (35%) Gaps:90/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQQQLILATGGYDHTIKV--WQAHTGNCIKTMRFVETSQVNALDRTPDKTRLAACGYQCIRLYDL 65
            :|...:||||..|.|::|  |.:     :||:                                 
plant   151 NQDGTVLATGAEDGTLRVFEWPS-----MKTL--------------------------------- 177

  Fly    66 ESNCTAPVINFDGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAAC 130
                    :|......:|..|.|.|.|.::.:.|             .|.| |::|..|....|.
plant   178 --------LNESKTHASVKSLTFSESGKFLVSLG-------------APLC-RVWDVNASAAIAS 220

  Fly   131 LHPNQVE------------------IAMGSQ-NGSVFLWDVKS--ERHERIVPEVDASIQDVAIS 174
            |...:.|                  :|..:| .||:..||..|  .|..:::.. :.||....:|
plant   221 LSKEKDEMFASCRFSVDNSGSEVLYVAANTQRGGSIITWDTTSWRRRSSKLIKR-NNSISAFNVS 284

  Fly   175 PDGRYLAAANNKGNCYIWSLTSQDQKMSTLRPNRKIPAHSRYILRCKFSPDSRLLLTTSGD 235
            .||:.||....:|:..|...|    ||.|.:..:|  ||...:....||||||.|::.|.|
plant   285 ADGKLLAVGTLEGDVLIIDST----KMQTNQIVKK--AHLGLVTALTFSPDSRCLVSVSFD 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lst8NP_572572.1 WD40 <3..306 CDD:225201 59/256 (23%)
WD40 8..284 CDD:238121 58/251 (23%)
WD40 repeat 41..78 CDD:293791 1/36 (3%)
WD40 repeat 83..121 CDD:293791 9/37 (24%)
WD40 repeat 127..162 CDD:293791 11/55 (20%)
WD40 repeat 168..205 CDD:293791 12/36 (33%)
WD40 repeat 217..254 CDD:293791 9/19 (47%)
WD40 repeat 259..283 CDD:293791
AT5G50650NP_680414.1 WD40 68..>344 CDD:225201 59/256 (23%)
WD40 <107..344 CDD:295369 59/256 (23%)
WD40 repeat 147..182 CDD:293791 12/76 (16%)
WD40 repeat 188..224 CDD:293791 12/49 (24%)
WD40 repeat 229..271 CDD:293791 8/41 (20%)
WD40 repeat 279..314 CDD:293791 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.