DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lst8 and PHF1

DIOPT Version :9

Sequence 1:	NP_572572.1	Gene:	Lst8 / 31903	FlyBaseID:	FBgn0264691	Length:	313	Species:	Drosophila melanogaster
Sequence 2:	NP_566961.1	Gene:	PHF1 / 824384	AraportID:	AT3G52190	Length:	398	Species:	Arabidopsis thaliana

Alignment Length:	123	Identity:	34/123 - (27%)
Similarity:	56/123 - (45%)	Gaps:	14/123 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   171 VAISPDGRYLAAANNKGNCYIWSLTSQDQKMSTLRPNRKIPAHSRYILRC-KFSPDSRLLLTTSG 234
            |::.|.|.|...:.:||.|.::.|......: |:.....:|..:..:.:| .||.|...|.....
plant    79 VSVHPGGDYFVCSTSKGGCKLFELVGGATGI-TILAKELLPLQNAGLQKCMAFSFDGSKLAVGGV 142

  Fly   235 DGTVCIWKTDDFSKWRELCI------ENYWVWDAAFSADSKWLFTASSDGIARLWKLQ 286
            ||.:.|      .:|..|.:      .:..:.|..||.||::|.|.|:||.||:||.:
plant   143 DGCLRI------MEWPNLSVILDEPKAHKSIRDMDFSLDSEFLATTSTDGSARIWKAE 194

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lst8	NP_572572.1	WD40	<3..306	CDD:225201	34/123 (28%)
		WD40	8..284	CDD:238121	32/119 (27%)
		WD40 repeat	41..78	CDD:293791
		WD40 repeat	83..121	CDD:293791
		WD40 repeat	127..162	CDD:293791
		WD40 repeat	168..205	CDD:293791	9/33 (27%)
		WD40 repeat	217..254	CDD:293791	10/37 (27%)
		WD40 repeat	259..283	CDD:293791	12/23 (52%)
PHF1	NP_566961.1	WD40 repeat	78..119	CDD:293791	9/40 (23%)
		WD40	127..>318	CDD:421866	24/74 (32%)
		WD40 repeat	127..162	CDD:293791	10/40 (25%)
		WD40 repeat	168..204	CDD:293791	14/27 (52%)
		WD40 repeat	210..250	CDD:293791
		WD40 repeat	258..294	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000