DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lst8 and STL2P

DIOPT Version :9

Sequence 1:NP_572572.1 Gene:Lst8 / 31903 FlyBaseID:FBgn0264691 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_178256.1 Gene:STL2P / 814675 AraportID:AT2G01470 Length:393 Species:Arabidopsis thaliana


Alignment Length:218 Identity:63/218 - (28%)
Similarity:100/218 - (45%) Gaps:26/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IKTMRFVETSQVNALDRTPDKTRLAACGYQ--CIRLYDLESNCTAPVINFDGVQKNVTRLGFQED 91
            ||.:|  :..|..||...|:.:.||| |.:  .:|::...|..|  ::|......:|..|.|.|.
plant   147 IKELR--DVGQQLALAFNPEGSVLAA-GAEDGTLRVFKWPSMNT--LLNESQAHSSVKCLTFSES 206

  Fly    92 GNWMFTAGEDHHVRIWDMIAAPPHCS------RIF-DCEAPVNAACLHPNQV-EIAMGSQ-NGSV 147
            |.::.:.| ....|:||:.|:....|      .:| .|...|::|   .|:| .||..:: .||:
plant   207 GQFLVSLG-GPVCRVWDVNASAAVASLSKEKDEMFASCRFSVDSA---GNEVLYIAANTERGGSI 267

  Fly   148 FLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSTLRPNRKIPA 212
            ...|.|..:.:...|....||....:|.||:.||....:|:..|...|    :|.|::..:|  |
plant   268 ITCDTKLWKRKWSKPIKKNSISAFNVSADGKLLAIGTLEGDVLILEST----RMQTIQVVKK--A 326

  Fly   213 HSRYILRCKFSPDSRLLLTTSGD 235
            |...:....||||||.|::.|.|
plant   327 HLGLVTALTFSPDSRGLVSVSFD 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lst8NP_572572.1 WD40 <3..306 CDD:225201 63/218 (29%)
WD40 8..284 CDD:238121 63/218 (29%)
WD40 repeat 41..78 CDD:293791 11/38 (29%)
WD40 repeat 83..121 CDD:293791 12/44 (27%)
WD40 repeat 127..162 CDD:293791 9/36 (25%)
WD40 repeat 168..205 CDD:293791 11/36 (31%)
WD40 repeat 217..254 CDD:293791 9/19 (47%)
WD40 repeat 259..283 CDD:293791
STL2PNP_178256.1 WD40 77..>354 CDD:225201 63/218 (29%)
WD40 <116..354 CDD:295369 63/218 (29%)
WD40 repeat 158..193 CDD:293791 11/37 (30%)
WD40 repeat 199..242 CDD:293791 11/43 (26%)
WD40 repeat 245..281 CDD:293791 10/38 (26%)
WD40 repeat 289..324 CDD:293791 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.