DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and YHC1

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_013401.1 Gene:YHC1 / 851005 SGDID:S000004289 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:43/192 - (22%)
Similarity:65/192 - (33%) Gaps:71/192 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YYCDYCCCFLKND-LNVRKLHNGGIAH--------------AIAKSNYLKRY------EDPKKIL 49
            |||:||..:|.:| |:|||.|..|..|              .|.|.|:.:|:      ::.:...
Yeast     4 YYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNHKRRHIGKRGRKERENSS 68

  Fly    50 TEERQKTPC-----KRYFGSYCKFETYCKFTHYSGDNLR-------------------ELEKLVL 90
            ..|..|..|     ||:. .:.|.....:....|.|.|:                   ::..||.
Yeast    69 QNETLKVTCLSNKEKRHI-MHVKKMNQKELAQTSIDTLKLLYDGSPGYSKVFVDANRFDIGDLVK 132

  Fly    91 ARK--------------KRKSRKKTNKCKRWPWKTHLRKGLPPSLQPINPEKLKQTDFELSW 138
            |.|              |:.||.:...|:..|:         |.|.  ||:||:.......|
Yeast   133 ASKLPQRANEKSAHHSFKQTSRSRDETCESNPF---------PRLN--NPKKLEPPKILSQW 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 17/47 (36%)
YHC1NP_013401.1 COG5136 1..217 CDD:227465 43/192 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.