DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and Zmat5

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001343319.1 Gene:Zmat5 / 67178 MGIID:1914428 Length:170 Species:Mus musculus


Alignment Length:151 Identity:44/151 - (29%)
Similarity:75/151 - (49%) Gaps:24/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKRY-FGSYC 66
            ||.|:||||....:::|:.||.|..|:.|..||..:...:.|...||.:|:.|.||::: ....|
Mouse     2 GKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQC 66

  Fly    67 KFETYCKFTHYSGDNLRELEKLVLARKKRKSRKKTNKCKRWPWKT------HLRKGLPPSLQPIN 125
            .|.:.|:|:|.|..:|:||.  |...::|::|:       ||.:|      ||...|....:.::
Mouse    67 DFGSNCRFSHMSEQDLQELS--VQVEEERRARE-------WPLETAELPEGHLEDWLEKRAKRLS 122

  Fly   126 ------PEKLKQTDFE--LSW 138
                  .|.::.|.|:  :.|
Mouse   123 SAPSSRAEPIRTTVFQYPVGW 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 15/35 (43%)
Zmat5NP_001343319.1 zf-U1 4..>46 CDD:389966 14/41 (34%)
zf-CCCH 55..76 CDD:366217 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842680
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5296
Isobase 1 0.950 - 0 Normalized mean entropy S7282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007275
OrthoInspector 1 1.000 - - oto93155
orthoMCL 1 0.900 - - OOG6_106589
Panther 1 1.100 - - LDO PTHR16465
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5190
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.