DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and snrpc

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001016598.1 Gene:snrpc / 549352 XenbaseID:XB-GENE-495092 Length:159 Species:Xenopus tropicalis


Alignment Length:50 Identity:19/50 - (38%)
Similarity:26/50 - (52%) Gaps:7/50 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YYCDYCCCFLKNDL-NVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQ 54
            :|||||..:|.:|. :|||.|..|..|   |.|....|:   |.:.|:.|
 Frog     4 FYCDYCDTYLTHDSPSVRKTHCSGRKH---KENVKDYYQ---KWMEEQAQ 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 15/33 (45%)
snrpcNP_001016598.1 zf-U1 1..38 CDD:368798 15/36 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..95
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.