DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and zmat5

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_017947412.1 Gene:zmat5 / 447964 XenbaseID:XB-GENE-984924 Length:214 Species:Xenopus tropicalis


Alignment Length:87 Identity:29/87 - (33%)
Similarity:48/87 - (55%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKRYFG-SYC 66
            |:.|:||||....:::|:.||.|..|:.|..:|..:...:.|..::|.||:.|..|:|:.. ..|
 Frog     2 GRRYFCDYCDRSFQDNLHNRKKHLNGVQHQRSKKAWFDAFRDASEVLAEEQTKKVCRRFIQCGQC 66

  Fly    67 KFETYCKFTHYSGDNLRELEKL 88
            .|...|:|:|.:   :.|||.|
 Frog    67 DFGPGCRFSHLT---VEELEAL 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 13/35 (37%)
zmat5XP_017947412.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541869at2759
OrthoFinder 1 1.000 - - FOG0007275
OrthoInspector 1 1.000 - - oto103409
Panther 1 1.100 - - LDO PTHR16465
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5190
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.