DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and zmat5

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001003771.1 Gene:zmat5 / 445314 ZFINID:ZDB-GENE-040808-31 Length:173 Species:Danio rerio


Alignment Length:162 Identity:42/162 - (25%)
Similarity:67/162 - (41%) Gaps:46/162 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GKSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKRYFGS-YC 66
            ||.||||||....:::|:.||.|..|:.|..||..:...:.|...:|.:||.|..|:::..: .|
Zfish     2 GKRYYCDYCDRSFQDNLHNRKKHLNGVQHHRAKKAWFDNFRDAATLLNDERSKEVCRKFVQTGQC 66

  Fly    67 KFETYCKFTHYSGDNLRELEKLVLARKKRK--------SRKKTNKCKRWPWKTHLRK-------- 115
            .|.|.|:|:|.|...::.||:.:...|::|        |.:..::     |.:...|        
Zfish    67 VFGTSCRFSHMSEKQMKMLEQKIDDEKRQKEDPDQDGSSERSVDE-----WLSRREKKLAALTSG 126

  Fly   116 ------------------------GLPPSLQP 123
                                    .|||||.|
Zfish   127 RVLRMEEEECTENIEIPPYLLSIPDLPPSLHP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 16/35 (46%)
zmat5NP_001003771.1 zf-U1 2..38 CDD:277622 16/35 (46%)
zf-CCCH 55..76 CDD:279036 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..111 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541869at2759
OrthoFinder 1 1.000 - - FOG0007275
OrthoInspector 1 1.000 - - oto40172
orthoMCL 1 0.900 - - OOG6_106589
Panther 1 1.100 - - LDO PTHR16465
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5190
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.