DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and Snrpc

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001257969.1 Gene:Snrpc / 361808 RGDID:1306065 Length:159 Species:Rattus norvegicus


Alignment Length:50 Identity:19/50 - (38%)
Similarity:26/50 - (52%) Gaps:7/50 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YYCDYCCCFLKNDL-NVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQ 54
            :|||||..:|.:|. :|||.|..|..|   |.|....|:   |.:.|:.|
  Rat     4 FYCDYCDTYLTHDSPSVRKTHCSGRKH---KENVKDYYQ---KWMEEQAQ 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 15/33 (45%)
SnrpcNP_001257969.1 zf-U1 1..38 CDD:368798 15/36 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..96
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.