DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and Snrpc

DIOPT Version :10

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001400503.1 Gene:Snrpc / 20630 MGIID:109489 Length:182 Species:Mus musculus


Alignment Length:50 Identity:19/50 - (38%)
Similarity:26/50 - (52%) Gaps:7/50 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YYCDYCCCFLKNDL-NVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQ 54
            :|||||..:|.:|. :|||.|..|..|   |.|....|:   |.:.|:.|
Mouse    27 FYCDYCDTYLTHDSPSVRKTHCSGRKH---KENVKDYYQ---KWMEEQAQ 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:389966 15/33 (45%)
SnrpcNP_001400503.1 zf-U1 27..61 CDD:368798 15/36 (42%)

Return to query results.
Submit another query.