DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31922 and ccch-2

DIOPT Version :9

Sequence 1:NP_722687.1 Gene:CG31922 / 319028 FlyBaseID:FBgn0051922 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001379227.1 Gene:ccch-2 / 178454 WormBaseID:WBGene00009537 Length:186 Species:Caenorhabditis elegans


Alignment Length:130 Identity:28/130 - (21%)
Similarity:44/130 - (33%) Gaps:42/130 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEERQKTPCKRY-FGSYCKFETYCKFTH 76
            |.:.:||:...:.             |||.|:..|...       ||.: ....|.:...|||.|
 Worm    53 CTIPDDLHEEMMR-------------LKRKENAFKTAL-------CKTFQLTRACSYGEQCKFAH 97

  Fly    77 YSGDNLRELEKLVLARKKR---KSRKKTNKCKRWPWKTHLRKGL-----------PPSLQPINPE 127
                   .:|:|.|.:|.|   ..:.||..|..:....|.:.|.           .|:..|:.|:
 Worm    98 -------SVEELQLKQKNRGVNHPKYKTVLCDNFSRTGHCKYGTKCQFIHRAVEPTPAQNPLMPQ 155

  Fly   128  127
             Worm   156  155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31922NP_722687.1 zf-U1 3..39 CDD:277622 3/25 (12%)
ccch-2NP_001379227.1 zf-CCCH 73..99 CDD:395517 8/39 (21%)
zf-CCCH 116..140 CDD:395517 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D587688at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.