DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31915 and COX11

DIOPT Version :9

Sequence 1:NP_723087.1 Gene:CG31915 / 319025 FlyBaseID:FBgn0051915 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_015193.1 Gene:COX11 / 855971 SGDID:S000006053 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:47/226 - (20%)
Similarity:81/226 - (35%) Gaps:69/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 TFDRNKLV--------ELQKSRQQEPLYDGPADDIIVFAISANS--------SGIPLH--ICNDI 275
            |||.:||.        ||:::|:::     ..|..:.|..|:.:        :.:||:  ||...
Yeast    55 TFDISKLTRNEIQQLRELKRARERK-----FKDRTVAFYFSSVAVLFLGLAYAAVPLYRAICART 114

  Fly   276 TFG---------YILQPLEPGDT-------LDHDVQQLVNLKSI-MVNELGAVP--PLLDYYKHL 321
            .||         :....|.|.||       ...:|.|::..|.: ...|:..:|  ..|.:||  
Yeast   115 GFGGIPITDRRKFTDDKLIPVDTEKRIRISFTSEVSQILPWKFVPQQREVYVLPGETALAFYK-- 177

  Fly   322 EKKPEKSKLSLDRIFMINLKRRPERREKMERLFDEIGIEAEHFPAV-----DGKELSTERLLEMG 381
                .|:....|.|.|......|             |..|::|..:     :.::|:....::|.
Yeast   178 ----AKNYSDKDIIGMATYSIAP-------------GEAAQYFNKIQCFCFEEQKLAAGEEIDMP 225

  Fly   382 VRFLPGYEDPYHHRAMTMGEIGCFLSHYNIW 412
            |.|   :.||.......|..|...:.||..:
Yeast   226 VFF---FIDPDFASDPAMRNIDDIILHYTFF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31915NP_723087.1 Glyco_tranf_GTA_type 32..>146 CDD:299700
Glyco_transf_25 334..515 CDD:133474 16/84 (19%)
COX11NP_015193.1 COX11 76..269 CDD:225716 40/205 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.