powered by:
Protein Alignment CG31915 and CG31648
DIOPT Version :9
Sequence 1: | NP_723087.1 |
Gene: | CG31915 / 319025 |
FlyBaseID: | FBgn0051915 |
Length: | 612 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_723086.1 |
Gene: | CG31648 / 33776 |
FlyBaseID: | FBgn0051648 |
Length: | 241 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 32/68 - (47%) |
Gaps: | 13/68 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 239 QKSRQQEPLYDGPADDIIVFAISANSSGIPLH--ICNDITFGYILQPLEPGDTLD-HDVQQLVNL 300
:|.|.:..||...|..:::..:| .:.:||: .|...::| |.|.. ||.:::.::
Fly 46 RKLRAKSTLYYITAGGVLIVGLS--YAAVPLYSIFCQAYSYG--------GTTTQGHDAEKVEHM 100
Fly 301 KSI 303
|.|
Fly 101 KKI 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3175 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.