DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31915 and CG31648

DIOPT Version :9

Sequence 1:NP_723087.1 Gene:CG31915 / 319025 FlyBaseID:FBgn0051915 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_723086.1 Gene:CG31648 / 33776 FlyBaseID:FBgn0051648 Length:241 Species:Drosophila melanogaster


Alignment Length:68 Identity:16/68 - (23%)
Similarity:32/68 - (47%) Gaps:13/68 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 QKSRQQEPLYDGPADDIIVFAISANSSGIPLH--ICNDITFGYILQPLEPGDTLD-HDVQQLVNL 300
            :|.|.:..||...|..:::..:|  .:.:||:  .|...::|        |.|.. ||.:::.::
  Fly    46 RKLRAKSTLYYITAGGVLIVGLS--YAAVPLYSIFCQAYSYG--------GTTTQGHDAEKVEHM 100

  Fly   301 KSI 303
            |.|
  Fly   101 KKI 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31915NP_723087.1 Glyco_tranf_GTA_type 32..>146 CDD:299700
Glyco_transf_25 334..515 CDD:133474
CG31648NP_723086.1 CtaG_Cox11 71..221 CDD:282318 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3175
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.