DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31915 and COX11

DIOPT Version :9

Sequence 1:NP_723087.1 Gene:CG31915 / 319025 FlyBaseID:FBgn0051915 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_004366.1 Gene:COX11 / 1353 HGNCID:2261 Length:276 Species:Homo sapiens


Alignment Length:135 Identity:26/135 - (19%)
Similarity:53/135 - (39%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QDEEDYQESPTVL-------IALLVRNKAHILPMFLSYLEQQDYPKERIAIWLRCDHSNDDSIEL 78
            |:||..:::.|.|       :.:|..:.|.: |::..|.:........:|     .|:: |.||.
Human    84 QEEERRRQNKTTLTYVAAVAVGMLGASYAAV-PLYRLYCQTTGLGGSAVA-----GHAS-DKIEN 141

  Fly    79 LRQWLDN------SGDLYHSVSYEFKPEEQ-----------SFVNGTSPYEWPASRFKHLIALKE 126
            :....|.      :.|::.|:.:.|:|::.           :|....:|.:.|.........:..
Human   142 MVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPF 206

  Fly   127 EAFQY 131
            ||.||
Human   207 EAGQY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31915NP_723087.1 Glyco_tranf_GTA_type 32..>146 CDD:299700 22/124 (18%)
Glyco_transf_25 334..515 CDD:133474
COX11NP_004366.1 PTZ00128 62..265 CDD:185464 26/135 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..92 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.