DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31915 and cox11

DIOPT Version :9

Sequence 1:NP_723087.1 Gene:CG31915 / 319025 FlyBaseID:FBgn0051915 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001076427.1 Gene:cox11 / 100005158 ZFINID:ZDB-GENE-050506-82 Length:259 Species:Danio rerio


Alignment Length:208 Identity:38/208 - (18%)
Similarity:72/208 - (34%) Gaps:61/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 EPYFRQNAVRILNQARNAAQYDLIYFGRKRLKEESEPAVENADNLVH--------AGYSYWTL-- 487
            :.:.|:...|:|||:|.|..:.     ||...:..:...:|...|.:        .|.||..:  
Zfish    40 QQFLRRTTQRLLNQSRGAKTHK-----RKHQSQADDWKKKNKTILTYIAAAGVGMIGMSYAAVPL 99

  Fly   488 -----------GYVISLQGALKLLAAKPL-DKLIPV----DEFLPLMFDRHPNKTWTEAFPKRNL 536
                       |..::.....::...||: |::|.|    |....:.::..|.::.....|....
Zfish   100 YRLYCQATGLGGAAVAGHDTEQVATMKPVRDRIIKVTFNADTHASIQWNFRPQQSEIYVVPGETA 164

  Fly   537 VAFSASPLLLYPIYYTGESGYISDTEDSQQISVETSE--EGEARLKSDREQVFDHEQEFKLNPEL 599
            :||..:                .:..|...|.:.|..  ..||....::.|.|..|:: :|||  
Zfish   165 LAFYRA----------------RNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQ-RLNP-- 210

  Fly   600 KLGESLSKSHQEL 612
                     |:|:
Zfish   211 ---------HEEV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31915NP_723087.1 Glyco_tranf_GTA_type 32..>146 CDD:299700
Glyco_transf_25 334..515 CDD:133474 21/107 (20%)
cox11NP_001076427.1 PTZ00128 30..248 CDD:185464 38/208 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3175
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.