DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31913 and COA1

DIOPT Version :9

Sequence 1:NP_723119.1 Gene:CG31913 / 319023 FlyBaseID:FBgn0051913 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_016867902.1 Gene:COA1 / 55744 HGNCID:21868 Length:147 Species:Homo sapiens


Alignment Length:149 Identity:36/149 - (24%)
Similarity:60/149 - (40%) Gaps:33/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SKRTM--GSICICGALASISGLAYMRWRLEDRVRQTEFYQLAIQQLRQHSGAVGLLGEPIKESGF 74
            |:|:|  |:..:...:....|.|.:.:.::....:..:|:||::||:.|..|...||.|:.....
Human     9 SRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYL 73

  Fly    75 NLSNEKNRCDEDKAQLQFHVQGPKDRGTVYFWASNNQKQGWLIDRLELETRQNPNTRY------- 132
            .|.:.:|..|...|:|:..|.|.|..|.:|..:|                |..|..||       
Human    74 KLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSS----------------RGGPFQRYPGKVTAV 122

  Fly   133 -------LLKKPPN-YSLV 143
                   |:|..|. :|.|
Human   123 GEREEDFLMKATPTPFSFV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31913NP_723119.1 Coa1 14..124 CDD:304481 26/111 (23%)
COA1XP_016867902.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144544
Domainoid 1 1.000 51 1.000 Domainoid score I11609
eggNOG 1 0.900 - - E1_2CI7A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5468
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1443294at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41183
orthoMCL 1 0.900 - - OOG6_109244
Panther 1 1.100 - - O PTHR47148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17124
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.