DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31913 and CG15653

DIOPT Version :9

Sequence 1:NP_723119.1 Gene:CG31913 / 319023 FlyBaseID:FBgn0051913 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_611540.1 Gene:CG15653 / 37388 FlyBaseID:FBgn0034578 Length:170 Species:Drosophila melanogaster


Alignment Length:180 Identity:85/180 - (47%)
Similarity:121/180 - (67%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGL--PSKRTMGSICICGALASISGLAYMRWRLEDRVRQTEFYQLAIQQLRQHSGAVGLLGEPIK 70
            :||  ||.||:|:||:.||:||||.:.||:|::||||:..|:|:||::.||.|.|||||||||||
  Fly     2 VGLKFPSNRTLGNICVYGAVASISAVMYMKWKMEDRVKSAEYYKLALKALRSHRGAVGLLGEPIK 66

  Fly    71 ESGFNLSNEKNRCDEDKAQLQFHVQGPKDRGTVYFWASNNQKQGWLIDRLELETRQNPNTRYLLK 135
            :||.:|||..|.|:.::|:.:..|:|.||:||:||||||...:|||||||||||:.||..|:|||
  Fly    67 DSGIDLSNANNNCNAEEARCEVAVRGSKDKGTLYFWASNQPDRGWLIDRLELETKLNPEKRFLLK 131

  Fly   136 KPPNYSLVSSDGDPDPPNAESSEETQQPQTPLEPQEQMEMEDKEQEPTVH 185
            |....:.       |.|.:.:.:..||..:      .:.:...:|:|..|
  Fly   132 KSEELTF-------DLPESITKQTAQQVDS------NVILSASDQQPETH 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31913NP_723119.1 Coa1 14..124 CDD:304481 65/109 (60%)
CG15653NP_611540.1 Coa1 10..121 CDD:304481 66/110 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444999
Domainoid 1 1.000 51 1.000 Domainoid score I11581
eggNOG 1 0.900 - - E1_2CI7A
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5477
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1443294at2759
OrthoFinder 1 1.000 - - FOG0016791
OrthoInspector 1 1.000 - - otm26153
orthoMCL 1 0.900 - - OOG6_109244
Panther 1 1.100 - - P PTHR47148
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13611
1110.800

Return to query results.
Submit another query.