DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31913 and coa-1

DIOPT Version :9

Sequence 1:NP_723119.1 Gene:CG31913 / 319023 FlyBaseID:FBgn0051913 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001367800.1 Gene:coa-1 / 13191872 WormBaseID:WBGene00195063 Length:138 Species:Caenorhabditis elegans


Alignment Length:133 Identity:31/133 - (23%)
Similarity:52/133 - (39%) Gaps:30/133 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MGSICICGALASISGLAYMRWRLEDRVRQTEFYQLAIQQLRQHSGAVGLLGEPIKESGFNLSNE- 79
            |||          :||...:..::.:||....|..:::.:.:|..|:..:|.||......||:. 
 Worm    17 MGS----------TGLYLAQKSVQWKVRALPHYNESLKIVMEHPKALEAIGAPISIGSVELSDRL 71

  Fly    80 KNRCDEDKAQLQFHVQGPKDRGTVYFWASNNQKQGWLIDRLELETRQNPNTRYLLKKPPNYSLVS 144
            .|..|:..::|:..|.|..|.|              .:|  .|..|:|..|.:...|   ..|..
 Worm    72 HNYVDKTTSRLRIPVTGVVDCG--------------FMD--VLAVRENDKTAFETAK---VRLFL 117

  Fly   145 SDG 147
            :||
 Worm   118 NDG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31913NP_723119.1 Coa1 14..124 CDD:304481 24/108 (22%)
coa-1NP_001367800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109244
Panther 1 1.100 - - O PTHR47148
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17124
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.