DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31913 and coa1

DIOPT Version :9

Sequence 1:NP_723119.1 Gene:CG31913 / 319023 FlyBaseID:FBgn0051913 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_017207845.1 Gene:coa1 / 108179075 ZFINID:ZDB-GENE-070912-694 Length:135 Species:Danio rerio


Alignment Length:100 Identity:30/100 - (30%)
Similarity:54/100 - (54%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GLAYMRWRLEDRVRQTEFYQLAIQQLRQHSGAVGLLG-EPIKESGFNLSNEKNRCDEDKAQLQFH 93
            |.|.|.:.::....::|:|:.|::||..:|.|:..|| .|:|....:||:..||.|...|||:..
Zfish    22 GCATMYYLMQKNFAKSEYYRQALEQLNSNSTAMASLGAPPLKIHNIHLSDRHNRIDHSSAQLKIP 86

  Fly    94 VQGPKDRGTVYFWASNNQ--KQGWLIDRLELETRQ 126
            |.|.|..|.:|..::.:.  ...|.:.::.|:.|:
Zfish    87 VTGSKTGGYLYTTSTRDSLTNSRWHLQQVVLKLRK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31913NP_723119.1 Coa1 14..124 CDD:304481 29/96 (30%)
coa1XP_017207845.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577675
Domainoid 1 1.000 51 1.000 Domainoid score I11581
eggNOG 1 0.900 - - E1_2CI7A
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5477
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1443294at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26153
orthoMCL 1 0.900 - - OOG6_109244
Panther 1 1.100 - - O PTHR47148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17124
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.