DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31913 and coa1

DIOPT Version :9

Sequence 1:NP_723119.1 Gene:CG31913 / 319023 FlyBaseID:FBgn0051913 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_002939958.1 Gene:coa1 / 100492393 XenbaseID:XB-GENE-6036209 Length:140 Species:Xenopus tropicalis


Alignment Length:129 Identity:35/129 - (27%)
Similarity:62/129 - (48%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LASISGLAYMRWRLEDRVRQTEFYQLAIQQLRQHSGAVGLLG-EPIKESGFNLSNEKNRCDEDKA 88
            :.|..|.|.|.:.::....:.|:|..|:::|..||.|:.:|| .|:|.....|:::.|..|:..|
 Frog    17 VVSGGGCALMYYYMQKTFAKKEYYLSALEKLNSHSEALEILGAPPLKVYNLRLTDKNNHVDQSTA 81

  Fly    89 QLQFHVQGPKDRGTVYFWA----SNNQKQGWLIDRLELETRQNPNTRYLLKKPPNYSLVSSDGD 148
            |::..|.|....|.:|..:    .||:   |.:..:.|:....      |:.|.:.|.| :|||
 Frog    82 QIKIPVSGTLSAGHLYTTSVRDRVNNR---WSLQEVILQLNNG------LRIPIHESNV-ADGD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31913NP_723119.1 Coa1 14..124 CDD:304481 28/103 (27%)
coa1XP_002939958.1 Coa1 14..126 CDD:370070 29/117 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12023
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1443294at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48393
Panther 1 1.100 - - O PTHR47148
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17124
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.140

Return to query results.
Submit another query.