DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31910 and CG13843

DIOPT Version :9

Sequence 1:NP_723211.1 Gene:CG31910 / 319021 FlyBaseID:FBgn0051910 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651069.1 Gene:CG13843 / 42668 FlyBaseID:FBgn0038993 Length:362 Species:Drosophila melanogaster


Alignment Length:254 Identity:66/254 - (25%)
Similarity:108/254 - (42%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HLTKQLKKHYGIEAEVLGLLVKLEMRYKEY-YNLYKC----------EMKAQK--------ILVE 79
            ||.|...||             .|..|..| :.|.:|          :|||.|        ..:|
  Fly    87 HLLKPTFKH-------------CENIYSRYDFKLEQCVHEQTLVVDQKMKALKNELEQAKPFQIE 138

  Fly    80 RIWLLTQ---RYLILISSEQSCR-YPEVYTLSTEEAIINEYEEKLEVLRASNNKMKNTLLEINQQ 140
            |:..:..   ||.||.||....: |||..:..|||..:.|::....::..||..:.|..|::::.
  Fly   139 RVKEMRYHGVRYRILASSTGCTKTYPEYISRMTEERALCEFQRAYNIVNQSNTDLSNLYLDMSES 203

  Fly   141 CKEFYAAYERLDKAQETPFIMG-DSHHRSIKYHKIMAVDIFNYLYATVLKLKCFMHQLDPVNLES 204
            .||......|||::..:.|:.. ||..:.|:       |:..|.:..::|||.:...:||:...|
  Fly   204 KKELDQRVARLDRSLGSTFLKELDSVLQIIE-------DLNTYFFGVIVKLKTWAELMDPMKEHS 261

  Fly   205 VEEYRDLLQNESAMEEFEEYLNNQFVYC---KCIYPIPTCPILKLKC---SHQNIANLK 257
            :|:|..||..|:   :|..:::.....|   :|....|..|.|...|   |.:::.|||
  Fly   262 IEDYLGLLSQET---DFRTFMSAGMENCTCKRCDKKDPLKPYLPCWCQMESSEDVTNLK 317



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471568
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.