DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31910 and CG30391

DIOPT Version :9

Sequence 1:NP_723211.1 Gene:CG31910 / 319021 FlyBaseID:FBgn0051910 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611566.2 Gene:CG30391 / 37423 FlyBaseID:FBgn0050391 Length:338 Species:Drosophila melanogaster


Alignment Length:219 Identity:70/219 - (31%)
Similarity:125/219 - (57%) Gaps:14/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LKKHYGIEAEVLGLLVKLEMRYKEYYNLYKCEMKAQKILVERIWLLTQRYLILISSEQSCRYPEV 103
            |:....:|..|:.:|:.:|.:|:.|::.|:.|::.|:|..|.:..|.|||.|.:..:.||..|::
  Fly    34 LRSSDAVEKRVIKILLVIEEKYRSYFDSYRKELELQRIAAETLHQLIQRYKITMQLDTSCTCPQI 98

  Fly   104 YTLSTEEAIINEYEEKLEVLRASNNKMKNTLLEINQQCKEFYAAYER----LDKAQETPFIMGDS 164
            |.:.:::||||::....:|:.:||   ||....| |..:.:...:.|    |::::|:|||:||:
  Fly    99 YDIESDDAIINKFYIHYQVIASSN---KNQCWAI-QSLRPYVLVFRRECAKLNRSEESPFILGDA 159

  Fly   165 HHRSIKYHKIMAVDIFNYLYATVLKLKCFMHQLDPVNLESVEEYRDLLQNESAMEEFEEYLNNQF 229
            .|:.|::...:..::|.|.|:..|:|.|....|||::|..:|.|..||:..   |:|.||..:..
  Fly   160 FHKPIQFFIDLVEELFAYFYSGHLQLDCAARLLDPLDLYRMECYMKLLEPN---EDFAEYFLHNI 221

  Fly   230 VYCKCIYPIPTCPILKLKCSHQNI 253
            .:|||:.|.|.||..:   .||.|
  Fly   222 SFCKCMRPPPMCPPYE---HHQKI 242



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FB6M
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014254
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.