DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gga and Wdfy1

DIOPT Version :9

Sequence 1:	NP_572571.1	Gene:	Gga / 31902	FlyBaseID:	FBgn0030141	Length:	660	Species:	Drosophila melanogaster
Sequence 2:	NP_001104749.1	Gene:	Wdfy1 / 69368	MGIID:	1916618	Length:	410	Species:	Mus musculus

Alignment Length:	85	Identity:	21/85 - (24%)
Similarity:	37/85 - (43%)	Gaps:	12/85 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   182 NLLLQYRMAQEARRNDLLAQHR---LVLCEVQETMQLLNQMLD------TYDPANQDVSETLHEL 237
            |.::.:.:.....|..||..|.   ..||.:|.|.||::...|      ..|.:.::..:.|..
Mouse   221 NSVIMWDIGGRKGRTLLLQGHHDRVQSLCYLQLTRQLVSCSADGGIAVWNMDVSREEAPQWLES- 284

  Fly   238 YKSCKK-HKPIFQHLPQLLD 256
             .||:| .:|.|.::.|:.|
Mouse   285 -DSCQKCEQPFFWNIKQMWD 303

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gga	NP_572571.1	VHS_GGA	7..144	CDD:239624
		GAT	210..284	CDD:281166	14/54 (26%)
		Alpha_adaptinC2	543..644	CDD:197886
Wdfy1	NP_001104749.1	WD40	16..272	CDD:421866	12/50 (24%)
		WD 1. /evidence=ECO:0000255	22..61
		WD40 repeat	28..67	CDD:293791
		WD 2. /evidence=ECO:0000255	66..105
		WD40 repeat	71..111	CDD:293791
		WD 3. /evidence=ECO:0000255	112..150
		WD40 repeat	118..153	CDD:293791
		WD 4. /evidence=ECO:0000255	153..192
		WD40 repeat	158..196	CDD:293791
		WD 5. /evidence=ECO:0000255	197..236		2/14 (14%)
		WD40 repeat	202..239	CDD:293791	3/17 (18%)
		WD 6. /evidence=ECO:0000255	240..279		9/38 (24%)
		WD40 repeat	245..269	CDD:293791	7/23 (30%)
		FYVE_WDFY1	279..354	CDD:277295	8/27 (30%)
		WD 7. /evidence=ECO:0000255	364..403
		WD40 repeat	369..393	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167831173
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930