DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gga and WDFY1

DIOPT Version :9

Sequence 1:NP_572571.1 Gene:Gga / 31902 FlyBaseID:FBgn0030141 Length:660 Species:Drosophila melanogaster
Sequence 2:NP_065881.1 Gene:WDFY1 / 57590 HGNCID:20451 Length:410 Species:Homo sapiens


Alignment Length:85 Identity:21/85 - (24%)
Similarity:37/85 - (43%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 NLLLQYRMAQEARRNDLLAQHR---LVLCEVQETMQLLNQMLD------TYDPANQDVSETLHEL 237
            |.::.:.:.....|..||..|.   ..||.:|.|.||::...|      ..|.:.::..:.|.. 
Human   221 NSIIMWDIGGRKGRTLLLQGHHDKVQSLCYLQLTRQLVSCSSDGGIAVWNMDVSREEAPQWLES- 284

  Fly   238 YKSCKK-HKPIFQHLPQLLD 256
             .||:| .:|.|.::.|:.|
Human   285 -DSCQKCEQPFFWNIKQMWD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GgaNP_572571.1 VHS_GGA 7..144 CDD:239624
GAT 210..284 CDD:281166 14/54 (26%)
Alpha_adaptinC2 543..644 CDD:197886
WDFY1NP_065881.1 WD40 16..272 CDD:330360 12/50 (24%)
WD 1 22..61
WD40 repeat 28..67 CDD:293791
WD 2 66..105
WD40 repeat 71..111 CDD:293791
WD 3 112..150
WD40 repeat 117..154 CDD:293791
WD 4 153..192
WD40 repeat 159..197 CDD:293791
WD 5 197..236 2/14 (14%)
WD40 repeat 202..239 CDD:293791 3/17 (18%)
WD 6 240..279 9/38 (24%)
WD40 repeat 246..314 CDD:293791 16/60 (27%)
FYVE_WDFY1 279..354 CDD:277295 8/27 (30%)
WD40 repeat 321..363 CDD:293791
WD 7 364..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.