powered by:
Protein Alignment Gga and wdfy2
DIOPT Version :9
Sequence 1: | NP_572571.1 |
Gene: | Gga / 31902 |
FlyBaseID: | FBgn0030141 |
Length: | 660 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991308.1 |
Gene: | wdfy2 / 492636 |
ZFINID: | ZDB-GENE-041111-211 |
Length: | 400 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 17/58 - (29%) |
Similarity: | 24/58 - (41%) |
Gaps: | 9/58 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 LCEVQETMQLLNQMLD------TYDPANQDVSETLHELYKSCKK-HKPIFQHLPQLLD 256
||....|.||::...| ..|...|:..|.|.. .||:| .:|.|.:..|:.|
Zfish 248 LCYAPHTRQLISCGSDGGIVIWNMDVTRQETPEWLDS--DSCQKCEQPFFWNFKQMWD 303
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170574134 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.