DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gga and wdfy2

DIOPT Version :9

Sequence 1:	NP_572571.1	Gene:	Gga / 31902	FlyBaseID:	FBgn0030141	Length:	660	Species:	Drosophila melanogaster
Sequence 2:	NP_991308.1	Gene:	wdfy2 / 492636	ZFINID:	ZDB-GENE-041111-211	Length:	400	Species:	Danio rerio

Alignment Length:	58	Identity:	17/58 - (29%)
Similarity:	24/58 - (41%)	Gaps:	9/58 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   206 LCEVQETMQLLNQMLD------TYDPANQDVSETLHELYKSCKK-HKPIFQHLPQLLD 256
            ||....|.||::...|      ..|...|:..|.|..  .||:| .:|.|.:..|:.|
Zfish   248 LCYAPHTRQLISCGSDGGIVIWNMDVTRQETPEWLDS--DSCQKCEQPFFWNFKQMWD 303

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gga	NP_572571.1	VHS_GGA	7..144	CDD:239624
		GAT	210..284	CDD:281166	15/54 (28%)
		Alpha_adaptinC2	543..644	CDD:197886
wdfy2	NP_991308.1	WD40	16..272	CDD:295369	6/23 (26%)
		WD40	18..394	CDD:225201	17/58 (29%)
		WD40 repeat	28..64	CDD:293791
		WD40 repeat	69..107	CDD:293791
		WD40 repeat	117..154	CDD:293791
		WD40 repeat	159..197	CDD:293791
		WD40 repeat	202..239	CDD:293791
		WD40 repeat	246..303	CDD:293791	16/56 (29%)
		FYVE_WDFY1_like	279..348	CDD:277258	9/27 (33%)
		WD40 repeat	316..363	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574134
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930