DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gga and wdfy1

DIOPT Version :9

Sequence 1:	NP_572571.1	Gene:	Gga / 31902	FlyBaseID:	FBgn0030141	Length:	660	Species:	Drosophila melanogaster
Sequence 2:	NP_001007058.2	Gene:	wdfy1 / 474326	ZFINID:	ZDB-GENE-041024-4	Length:	410	Species:	Danio rerio

Alignment Length:	77	Identity:	22/77 - (28%)
Similarity:	32/77 - (41%)	Gaps:	12/77 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   183 LLLQ--YRMAQEARRNDLLAQHRLVLCEVQETMQLLNQMLDTYDPANQDVSETLHELYKSCKK-H 244
            ||||  :...|..|...|..|  ||.|.....:.:.|.     |...|:..:.|..  .||:| .
Zfish   236 LLLQGHHEKVQALRYLPLTRQ--LVSCSADGGITVWNM-----DTTRQEAPQWLDS--DSCQKCE 291

  Fly   245 KPIFQHLPQLLD 256
            :|.|.::.|:.|
Zfish   292 QPFFWNIKQMWD 303

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gga	NP_572571.1	VHS_GGA	7..144	CDD:239624
		GAT	210..284	CDD:281166	11/48 (23%)
		Alpha_adaptinC2	543..644	CDD:197886
wdfy1	NP_001007058.2	WD40	16..275	CDD:295369	13/45 (29%)
		WD40	20..394	CDD:225201	22/77 (29%)
		WD40 repeat	28..67	CDD:293791
		WD40 repeat	71..111	CDD:293791
		WD40 repeat	118..153	CDD:293791
		WD40 repeat	158..196	CDD:293791
		WD40 repeat	202..239	CDD:293791	2/2 (100%)
		WD40 repeat	245..269	CDD:293791	7/25 (28%)
		FYVE_WDFY1	279..354	CDD:277295	8/27 (30%)
		WD40 repeat	321..363	CDD:293791
		WD40	355..394	CDD:197651
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574136
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930