DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gga and WDFY2

DIOPT Version :9

Sequence 1:	NP_572571.1	Gene:	Gga / 31902	FlyBaseID:	FBgn0030141	Length:	660	Species:	Drosophila melanogaster
Sequence 2:	NP_443182.1	Gene:	WDFY2 / 115825	HGNCID:	20482	Length:	400	Species:	Homo sapiens

Alignment Length:	77	Identity:	18/77 - (23%)
Similarity:	30/77 - (38%)	Gaps:	14/77 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   571 AQNKSRQPVRDFQFEASVKKPCKVRLLTPTDSQMPPHKPFRPAT--------PINQVMLLLNPTG 627
            :..:|..|:..|:||..|...|...:   ||.:..|...|..:.        ...:..||.:.|.
Human   326 SSKRSSIPLMGFEFEVRVCDSCHEAI---TDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTD 387

  Fly   628 KAV---DVTCIV 636
            |.:   |:|.:|
Human   388 KVIKLWDMTPVV 399

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gga	NP_572571.1	VHS_GGA	7..144	CDD:239624
		GAT	210..284	CDD:281166
		Alpha_adaptinC2	543..644	CDD:197886	18/77 (23%)
WDFY2	NP_443182.1	WD40	16..272	CDD:330360
		WD 1	22..61
		WD40 repeat	27..64	CDD:293791
		WD 2	66..105
		WD40 repeat	72..132	CDD:293791
		WD 3	112..150
		WD 4	153..192
		WD40 repeat	159..197	CDD:293791
		WD 5	197..236
		WD40 repeat	203..240	CDD:293791
		WD 6	240..279
		WD40 repeat	245..283	CDD:293791
		FYVE_WDFY1_like	279..348	CDD:277258	6/21 (29%)
		WD40 repeat	321..363	CDD:293791	10/39 (26%)
		WD 7	364..399		6/34 (18%)
		WD40 repeat	369..395	CDD:293791	4/25 (16%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165141226
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930