DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst27D and Eb1

DIOPT Version :9

Sequence 1:NP_001285705.1 Gene:Mst27D / 319019 FlyBaseID:FBgn0051907 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_724495.2 Gene:Eb1 / 35584 FlyBaseID:FBgn0027066 Length:297 Species:Drosophila melanogaster


Alignment Length:358 Identity:84/358 - (23%)
Similarity:135/358 - (37%) Gaps:100/358 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNMVKRVTASKYDVVSVKTLLMFINSKLDCELRGFEDLKTGAVYCQLMHRLFPNSIQIHKVKFYT 77
            ||:... ..|::|      :|.::|..|..:....|:|.|||.|||.|..|||||:.:.:|||.|
  Fly     8 TNVTSE-NLSRHD------MLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKRVKFRT 65

  Fly    78 NDISDFQLNFRLLNNCFQKLRVTVYMPVHELTLGHNQ--VVFCNWIYKFYEANDKGNEYDARKVR 140
            |...::..||::|...|:|:.|...:||.:|..|..|  ..|..|..||::||..|.|||....|
  Fly    66 NLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYDGREYDPVAQR 130

  Fly   141 KGSPIGLDNSY-KVASISTGSTCSVHKCQSMVFNYAKKPVRFERQNSLDALSFRPGIFKSIRREK 204
            .|..:|..|.: .......||:                      .|.|..:..||       .:.
  Fly   131 GGVKLGNGNGHGSNGGSGVGSS----------------------NNDLHLMHRRP-------LQA 166

  Fly   205 PTEQANPEPQQTKNIKKSSQFLAESKHVSLPSDSEDELELKAQKRYLQDQFVKKLNSSKNDEKTG 269
            |. .....|.:.......|:.|..:.:.:..|                     ::|:..|  .||
  Fly   167 PA-SGGRMPARVIASTAVSKVLPRTNNAAPAS---------------------RINACAN--STG 207

  Fly   270 TDATSKISEIPRPNPENEQLNTVCEKYEQETSDLRSNLNLIDKLELQLQNLQIDKEKLTNKLSRV 334
            |...:.:|.    :..|:|:    |:...:..|:|.|          |:.|:.:::...:||..:
  Fly   208 TVKKNDVSN----SVNNQQI----EEMSNQVMDMRIN----------LEGLEKERDFYFSKLRDI 254

  Fly   335 ESILNKHDLNPEKAVLKLRKLLLNQAQTARVHP 367
            |                   :|..:|..|..||
  Fly   255 E-------------------ILCQEADDAEAHP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst27DNP_001285705.1 CH 30..124 CDD:278723 35/95 (37%)
Eb1NP_724495.2 BIM1 16..293 CDD:227542 82/349 (23%)
CH 16..114 CDD:278723 37/103 (36%)
EB1 241..279 CDD:281288 8/47 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1295
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.