DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a1

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_077347.1 Gene:Slc6a1 / 79212 RGDID:620533 Length:599 Species:Rattus norvegicus


Alignment Length:205 Identity:54/205 - (26%)
Similarity:91/205 - (44%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGILHG--GWLLFIIAYLMGMLFYSLPIFLIQAFLG 146
            |..|....||..:...:|..   ...:..|..|.|  |...|:|.|.:.::|..:|:||::..||
  Rat    44 RDTWKGRFDFLMSCVGYAIG---LGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLG 105

  Fly   147 QFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNT 211
            |::|.|.:..:::||:|||:|.|..:|:.....||.:.....:.|..||....:||..|:|.|||
  Rat   106 QYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNT 170

  Fly   212 QECSLHENYDVDFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHW 276
            ..|  ..||          :|.....:.|:|:....:.. |.:: ..:..|..:         .|
  Rat   171 DRC--FSNY----------SLVNTTNMTSAVVEFWERNM-HQMT-DGLDKPGQI---------RW 212

  Fly   277 PAAVNVA-SW 285
            |.|:.:| :|
  Rat   213 PLAITLAIAW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 37/119 (31%)
Cuticle_4 276..344 CDD:292577 5/11 (45%)
Slc6a1NP_077347.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
SLC6sbd_GAT1 2..599 CDD:212075 54/205 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..599
PDZ-binding 597..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11616
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.