DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SLC6A4

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001036.1 Gene:SLC6A4 / 6532 HGNCID:11050 Length:630 Species:Homo sapiens


Alignment Length:368 Identity:91/368 - (24%)
Similarity:141/368 - (38%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LNNCMLLGDCENSEHGTE---------LPGDFIGEPVETESGGGMGGSLALAARRIRSRQVHSMA 64
            ||:...|..||:.|...|         .|||      :.|||....|..|:.:........||:.
Human     6 LNSQKQLSACEDGEDCQENGVLQKVVPTPGD------KVESGQISNGYSAVPSPGAGDDTRHSIP 64

  Fly    65 VRTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWL 121
            ..|.:....|     |...|..|.|..||..:...:|        |..:.:.        :||. 
Human    65 ATTTTLVAEL-----HQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQ--------NGGG- 115

  Fly   122 LFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAA 185
            .|::.|.:..:|..:|:|.::..|||:..:|.||.:| :.||||||||||.::.....:||:...
Human   116 AFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM 180

  Fly   186 VVPLIYTVNSIHPVIPWMSCNNSWNTQEC-----------SLHE--------------------- 218
            ...|.|.::|....:||.||.|||||..|           :||.                     
Human   181 AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGL 245

  Fly   219 ------NYDVDFAVAVIFTL---ALAMGVQSS--VIPLLSQVAGHGLSYTAVSGPAVVASPWA-- 270
                  ::.:...:.:|||:   ::..||::|  |:.:.:......||...|.| |.:...|.  
Human   246 QDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRG-ATLPGAWRGV 309

  Fly   271 --VPAAHWPAAVNVASWPPAAIHAAAPAVLA-APAPAVVAAHA 310
              ....:|...:....|    |.|||....: .|...|:.|.|
Human   310 LFYLKPNWQKLLETGVW----IDAAAQIFFSLGPGFGVLLAFA 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 45/163 (28%)
Cuticle_4 276..344 CDD:292577 10/36 (28%)
SLC6A4NP_001036.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59 15/58 (26%)
5HT_transport_N 24..64 CDD:397524 10/45 (22%)
SLC6sbd_SERT 79..615 CDD:271399 71/284 (25%)
Interaction with RAB4A 616..624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.