Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035.1 | Gene: | SLC6A3 / 6531 | HGNCID: | 11049 | Length: | 620 | Species: | Homo sapiens |
Alignment Length: | 252 | Identity: | 59/252 - (23%) |
---|---|---|---|
Similarity: | 100/252 - (39%) | Gaps: | 73/252 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
Fly 141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
Fly 206 NNSWNTQECS---------------------------------LHENYDVD-------------F 224
Fly 225 AVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVN 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 41/165 (25%) |
Cuticle_4 | 276..344 | CDD:292577 | 2/6 (33%) | ||
SLC6A3 | NP_001035.1 | SLC6sbd_DAT1 | 60..614 | CDD:212083 | 59/252 (23%) |
Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:12177201 | 561..590 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |