DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SLC6A3

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001035.1 Gene:SLC6A3 / 6531 HGNCID:11049 Length:620 Species:Homo sapiens


Alignment Length:252 Identity:59/252 - (23%)
Similarity:100/252 - (39%) Gaps:73/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            |..|.|..||..:....|        |..|.:.        :||. .|::.||:.|:...:|:|.
Human    60 RETWGKKIDFLLSVIGFAVDLANVWRFPYLCYK--------NGGG-AFLVPYLLFMVIAGMPLFY 115

  Fly   141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            ::..||||:..|....:::.||.||:|:.::|::|....:|::.....|.|..:|....:||:.|
Human   116 MELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC 180

  Fly   206 NNSWNTQECS---------------------------------LHENYDVD-------------F 224
            |||||:..||                                 ||:::.:|             .
Human   181 NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLV 245

  Fly   225 AVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPAAVN 281
            .|.|:...:|..||::|         |..:..||.. |.||.:...:.....|.|::
Human   246 LVIVLLYFSLWKGVKTS---------GKVVWITATM-PYVVLTALLLRGVTLPGAID 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 41/165 (25%)
Cuticle_4 276..344 CDD:292577 2/6 (33%)
SLC6A3NP_001035.1 SLC6sbd_DAT1 60..614 CDD:212083 59/252 (23%)
Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:12177201 561..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.