DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SLC6A2

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001165975.1 Gene:SLC6A2 / 6530 HGNCID:11048 Length:628 Species:Homo sapiens


Alignment Length:292 Identity:64/292 - (21%)
Similarity:113/292 - (38%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VETESGGG-MGGSLALAARRIRSRQVHSMAVRTGSAYDTLERPYRHD-KCRGRWAKSADFYFASC 98
            |:.|:.|. .|....|.||    :....:.|:..:....|..|...| :.|..|.|..||..:..
Human    10 VQPENNGADTGPEQPLRAR----KTAELLVVKERNGVQCLLAPRDGDAQPRETWGKKIDFLLSVV 70

  Fly    99 THA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTIS 155
            ..|        |..|.:.        :||. .|:|.|.:.::...:|:|.::..|||::..|..:
Human    71 GFAVDLANVWRFPYLCYK--------NGGG-AFLIPYTLFLIIAGMPLFYMELALGQYNREGAAT 126

  Fly   156 AFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNTQECS----- 215
            .:::.|.|||:|||::|:.|....||::.....|.|..:|....:||..|.::||:..|:     
Human   127 VWKICPFFKGVGYAVILIALYVGFYYNVIIAWSLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLL 191

  Fly   216 -----------------------------LHEN---YDVD----------FAVAVIFTLALAMGV 238
                                         |||:   :|:.          ..|.::...:|..||
Human   192 NGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV 256

  Fly   239 QSS--------VIP--LLSQVAGHGLSYTAVS 260
            ::|        .:|  :|..:..||::....|
Human   257 KTSGKVVWITATLPYFVLFVLLVHGVTLPGAS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 38/174 (22%)
Cuticle_4 276..344 CDD:292577
SLC6A2NP_001165975.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/12 (33%)
SLC6sbd_NET 56..612 CDD:212081 53/242 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.