Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001165975.1 | Gene: | SLC6A2 / 6530 | HGNCID: | 11048 | Length: | 628 | Species: | Homo sapiens |
Alignment Length: | 292 | Identity: | 64/292 - (21%) |
---|---|---|---|
Similarity: | 113/292 - (38%) | Gaps: | 80/292 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 VETESGGG-MGGSLALAARRIRSRQVHSMAVRTGSAYDTLERPYRHD-KCRGRWAKSADFYFASC 98
Fly 99 THA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTIS 155
Fly 156 AFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNTQECS----- 215
Fly 216 -----------------------------LHEN---YDVD----------FAVAVIFTLALAMGV 238
Fly 239 QSS--------VIP--LLSQVAGHGLSYTAVS 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 38/174 (22%) |
Cuticle_4 | 276..344 | CDD:292577 | |||
SLC6A2 | NP_001165975.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | 4/12 (33%) | |
SLC6sbd_NET | 56..612 | CDD:212081 | 53/242 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |