DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SLC6A1

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001335179.1 Gene:SLC6A1 / 6529 HGNCID:11042 Length:599 Species:Homo sapiens


Alignment Length:230 Identity:57/230 - (24%)
Similarity:96/230 - (41%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ERPYRHDK----------------CRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHG--GWL 121
            |.|..:||                .|..|....||..:...:|..   ...:..|..|.|  |..
Human    19 EAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFDFLMSCVGYAIG---LGNVWRFPYLCGKNGGG 80

  Fly   122 LFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAV 186
            .|:|.|.:.::|..:|:||::..|||::|.|.:..:::||:|||:|.|..:|:.....||.:...
Human    81 AFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIIS 145

  Fly   187 VPLIYTVNSIHPVIPWMSCNNSWNTQECSLHENYDVDFAVAVIFTLALAMGVQSSVIPLLSQVAG 251
            ..:.|..||....:||..|:|.|||..|  ..||          ::.....:.|:|:....:.. 
Human   146 WAIYYLYNSFTTTLPWKQCDNPWNTDRC--FSNY----------SMVNTTNMTSAVVEFWERNM- 197

  Fly   252 HGLSYTAVSGPAVVASPWAVPAAHWPAAVNVA-SW 285
            |.:: ..:..|..:         .||.|:.:| :|
Human   198 HQMT-DGLDKPGQI---------RWPLAITLAIAW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 36/119 (30%)
Cuticle_4 276..344 CDD:292577 5/11 (45%)
SLC6A1NP_001335179.1 SLC6sbd_GAT1 2..599 CDD:212075 57/230 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..599
PDZ-binding 597..599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.