Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028251.1 | Gene: | Slc6a17 / 613226 | RGDID: | 1587185 | Length: | 727 | Species: | Rattus norvegicus |
Alignment Length: | 265 | Identity: | 55/265 - (20%) |
---|---|---|---|
Similarity: | 97/265 - (36%) | Gaps: | 71/265 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 NSEHGTELPGDFIG--EPVETES-----GGGMGGSLALAARRIRSRQVHSMAVRTGSAYDTLERP 77
Fly 78 YRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIF 139
Fly 140 LIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWM 203
Fly 204 SCNNSWN------TQEC-------------------SLHENYDVDFAVAV-------IFTLALAM 236
Fly 237 GVQSS 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 33/152 (22%) |
Cuticle_4 | 276..344 | CDD:292577 | |||
Slc6a17 | NP_001028251.1 | SLC6sbd_NTT4 | 60..648 | CDD:271403 | 42/202 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 680..727 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0733 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |