DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and si:ch211-132b12.2

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001038688.1 Gene:si:ch211-132b12.2 / 571877 ZFINID:ZDB-GENE-050420-178 Length:582 Species:Danio rerio


Alignment Length:152 Identity:46/152 - (30%)
Similarity:71/152 - (46%) Gaps:31/152 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGILHG--------------GWLLFIIAYLMGMLFY 134
            ||.|....:|.               |:..||:.|              |...|::.||:.::..
Zfish    11 RGNWGSKTEFI---------------LAVAGIVIGLGNVWRFPYLCYKNGGGAFLVPYLVFVVTC 60

  Fly   135 SLPIFLIQAFLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHP 198
            .:|:||::..:||::..|.|:.: |:.|:.:|||||..|:.|.:..||.|.....|.|...|...
Zfish    61 GVPLFLLETAMGQYTQEGGITCWHRLCPLAEGIGYAGQLIVLYSCMYYIIILAWALFYLAFSFSS 125

  Fly   199 VIPWMSCNNSWNTQEC-SLHEN 219
            .:||.||:|.|||..| :|.||
Zfish   126 QLPWASCDNIWNTDACVNLAEN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 37/99 (37%)
Cuticle_4 276..344 CDD:292577
si:ch211-132b12.2NP_001038688.1 SLC6sbd-TauT-like 11..550 CDD:271387 46/152 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.