Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017211707.1 | Gene: | si:ch211-283g2.1 / 569007 | ZFINID: | ZDB-GENE-060531-57 | Length: | 581 | Species: | Danio rerio |
Alignment Length: | 263 | Identity: | 59/263 - (22%) |
---|---|---|---|
Similarity: | 104/263 - (39%) | Gaps: | 69/263 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGIL--HGGWLLFIIAYLMGMLFYSLPIFLIQAFLG 146
Fly 147 QFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWN 210
Fly 211 TQECS---------------------------LHENYDVDFAVAVIFTLA-------LAMGVQSS 241
Fly 242 VIPLLSQVAGHGLSYTAVSGP-----AVVASPWAVPAA----------HWPAAVNVASWPPAAIH 291
Fly 292 AAA 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 36/154 (23%) |
Cuticle_4 | 276..344 | CDD:292577 | 8/19 (42%) | ||
si:ch211-283g2.1 | XP_017211707.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |