DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and slc6a8

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001314797.1 Gene:slc6a8 / 567544 ZFINID:ZDB-GENE-071024-2 Length:652 Species:Danio rerio


Alignment Length:160 Identity:47/160 - (29%)
Similarity:79/160 - (49%) Gaps:18/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MAVRTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGG 119
            |:..|| |...:|:.......|..|.:..||..:....|        |..|.:.        :||
Zfish    44 MSAATG-AISAVEKKREGYPERETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYK--------NGG 99

  Fly   120 WLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIA 184
            . :|:|.|::.:....:|||.::..||||..:|:|:.:.:||:|||:|||.:::.....|||.:.
Zfish   100 G-VFLIPYVLFIFLGGIPIFFLEIALGQFMKAGSINVWNIAPLFKGLGYASMVIVFFCNTYYIMV 163

  Fly   185 AVVPLIYTVNSIHPVIPWMSCNNSWNTQEC 214
            ......|.:.|.:..:||.:|:|.|||:.|
Zfish   164 LAWGFYYFIKSFNATLPWSTCDNPWNTENC 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 33/92 (36%)
Cuticle_4 276..344 CDD:464954
slc6a8NP_001314797.1 SLC6sbd_CT1 64..652 CDD:271397 42/139 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.