DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and slc6a2

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_009301625.1 Gene:slc6a2 / 565776 ZFINID:ZDB-GENE-110408-4 Length:625 Species:Danio rerio


Alignment Length:181 Identity:46/181 - (25%)
Similarity:79/181 - (43%) Gaps:42/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFL 140
            |..|.|..||..:....|        |..|.:.        :||. .|:|.|::.:....:|:|.
Zfish    64 RETWGKKMDFLLSVIGFAVDLANVWRFPYLCYK--------NGGG-AFLIPYVLFLFIAGMPLFY 119

  Fly   141 IQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            ::..|||::..|..:.:::.|:|||:||.::::.|....||::.....|.|...|:...:||:.|
Zfish   120 MELALGQYNREGAATLWKICPVFKGVGYTVIVIALYVGFYYNVIIAWSLYYLYASLTSELPWLHC 184

  Fly   206 NNSWNTQECSLHENYDVDFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSY 256
            ||.||:..|:  |..|::                       ..|.|:|.||
Zfish   185 NNPWNSPNCT--EPKDIN-----------------------GTVLGNGTSY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 31/119 (26%)
Cuticle_4 276..344 CDD:292577
slc6a2XP_009301625.1 SLC5-6-like_sbd 64..623 CDD:294310 46/181 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.