DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and si:ch211-132b12.6

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001038523.1 Gene:si:ch211-132b12.6 / 564583 ZFINID:ZDB-GENE-050420-179 Length:577 Species:Danio rerio


Alignment Length:135 Identity:49/135 - (36%)
Similarity:74/135 - (54%) Gaps:8/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQAFL 145
            ||.|.|.|:|..|...:...   ...:..|..|   :||. :|:|.||:.::...||:||::..:
Zfish    11 RGFWGKKAEFLLAVAGNVVG---LGNVWRFPYLCYRNGGG-VFLIPYLVFVVTCGLPLFLLETAM 71

  Fly   146 GQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSW 209
            |||:..|.|:.: |:.|:.:|:|||..|..|.:..||:|.....|.|.|:|....:||:||||.|
Zfish    72 GQFTHEGGITCWHRLCPLAQGVGYAGQLTVLYSCMYYTIILAWALFYLVSSFSSQLPWVSCNNIW 136

  Fly   210 NTQEC 214
            ||..|
Zfish   137 NTDNC 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 38/93 (41%)
Cuticle_4 276..344 CDD:292577
si:ch211-132b12.6NP_001038523.1 SLC6sbd-TauT-like 11..550 CDD:271387 49/135 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.