DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SLC6A20

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001372612.1 Gene:SLC6A20 / 54716 HGNCID:30927 Length:603 Species:Homo sapiens


Alignment Length:263 Identity:60/263 - (22%)
Similarity:106/263 - (40%) Gaps:58/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGIL---HGGWLLFIIAYLMGMLFYSLPIFLIQ 142
            :|.|..||.|..|.||..::|..   ...:..|..|   :||. .|::.|::.::...:|:..::
Human     2 EKARPLWANSLQFVFACISYAVG---LGNVWRFPYLCQMYGGG-SFLVPYIIMLIVEGMPLLYLE 62

  Fly   143 AFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC- 205
            ..:||....|:|.|:| ::|...|:|.|.::::.....||::.......|..:|....:||..| 
Human    63 LAVGQRMRQGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLPWSVCP 127

  Fly   206 ---NNSWNTQEC-------------------SLHENYDVDFAVAVIFTLA-------LAMGVQSS 241
               |::...:||                   ||.||..|.:..|:...||       :..|.:|:
Human   128 LNGNHTGYDEECEKASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLVVYLCILRGTEST 192

  Fly   242 ---------------VIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAAHWPA-AVNVASWPPAAI 290
                           :|.|:..:..||    |.:|...:.:|....|....| .:...:.|.|.|
Human   193 GKVVYFTASLPYCVLIIYLIRGLTLHG----ATNGLMYMFTPKGSSALSLLAFQIEQLANPKAWI 253

  Fly   291 HAA 293
            :||
Human   254 NAA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 33/165 (20%)
Cuticle_4 276..344 CDD:292577 6/19 (32%)
SLC6A20NP_001372612.1 SLC6sbd_SIT1 2..588 CDD:271401 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.