Sequence 1: | NP_723310.1 | Gene: | CG31904 / 319016 | FlyBaseID: | FBgn0260479 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_059044.1 | Gene: | Slc6a8 / 50690 | RGDID: | 619711 | Length: | 635 | Species: | Rattus norvegicus |
Alignment Length: | 207 | Identity: | 55/207 - (26%) |
---|---|---|---|
Similarity: | 88/207 - (42%) | Gaps: | 50/207 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 SEHGTELPGDFI-----GEPVETESGGGMGGSLALAARRIRSRQVHSMAVRTGSAYDTLERPYRH 80
Fly 81 DKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137
Fly 138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202
Fly 203 MSCNNSWNTQEC 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31904 | NP_723310.1 | SLC5-6-like_sbd | 123..>243 | CDD:294310 | 33/92 (36%) |
Cuticle_4 | 276..344 | CDD:292577 | |||
Slc6a8 | NP_059044.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..47 | 11/46 (24%) | |
SLC6sbd_CT1 | 52..621 | CDD:271397 | 42/139 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11616 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |