DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and RGD1562492

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001102616.1 Gene:RGD1562492 / 499151 RGDID:1562492 Length:743 Species:Rattus norvegicus


Alignment Length:96 Identity:24/96 - (25%)
Similarity:46/96 - (47%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 FIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSIAAV 186
            |::.||:.:|...:|:..::..:||:.....|.|:: :.|...|:||:.:|.....:.|.|....
  Rat    87 FLLMYLILLLLLGIPLMYMEMVIGQWLRVDNIRAWKHLVPWLSGVGYSSMLACALVILYNSALVS 151

  Fly   187 VPLIYTVNSIHPVIPWMSCN--NSWNTQECS 215
            ..|.|...|.....||.:|.  .:::|.:.|
  Rat   152 WSLFYLGQSFDYPTPWENCPLVKNFSTSDIS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 24/96 (25%)
Cuticle_4 276..344 CDD:292577
RGD1562492NP_001102616.1 SLC5-6-like_sbd 50..621 CDD:382020 24/96 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.