DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and slc6a9

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_005163551.1 Gene:slc6a9 / 494490 ZFINID:ZDB-GENE-050105-3 Length:653 Species:Danio rerio


Alignment Length:149 Identity:43/149 - (28%)
Similarity:76/149 - (51%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PYRHDK--CRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGM 131
            |.:.|:  .||.|....:|...|..:|        |..|.:.        :||. .|:..|.:.:
Zfish    22 PVKRDENSRRGNWGNQIEFVLTSVGYAVGLGNVWRFPYLCYR--------NGGG-AFMFPYFIML 77

  Fly   132 LFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSI 196
            :|..:|:|.::...|||:|.|.:..::|:|:|||:||.:::::.....||::...:...|...|:
Zfish    78 VFCGIPLFFLELSFGQFTSLGCLGVWKVSPMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFMSM 142

  Fly   197 HPVIPWMSCNNSWNTQECS 215
            ..::||..|||.|||.:||
Zfish   143 TNLLPWTYCNNPWNTPDCS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 31/93 (33%)
Cuticle_4 276..344 CDD:464954
slc6a9XP_005163551.1 SLC6sbd_GlyT1 15..598 CDD:212067 43/149 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.