DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and slc6a5

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001009557.1 Gene:slc6a5 / 494450 ZFINID:ZDB-GENE-050105-2 Length:786 Species:Danio rerio


Alignment Length:272 Identity:74/272 - (27%)
Similarity:104/272 - (38%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KGICGEQLNNCMLLGDCE-NSEHGT---ELPG-DFIG--EPVETESGGGMGGSLALAARRIRSRQ 59
            |..|..:...|    |.| |..:||   ..|| .|.|  ..|..:|.|.|..|...|.....|. 
Zfish    50 KTFCPSENKPC----DMEANKAYGTFKNTAPGPTFAGVNSAVRKDSVGKMDASTGKATSDFMSN- 109

  Fly    60 VHSMAVR-----------------------------------TGSAYDTLERPYRHD-------- 81
             :..|||                                   ||...|...|.::.|        
Zfish   110 -NQSAVRIAAEHNNSTGDWTSMSQTTIILGTDGNTSVLPGTVTGPPTDDTGRLFQDDDDDDGGDE 173

  Fly    82 -KCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137
             |.||.|:...||..:...:|        |..|.|.        :||. .|:|.||:.:....:|
Zfish   174 NKARGNWSNKLDFILSMVGYAVGLGNVWRFPYLAFQ--------NGGG-AFLIPYLIMLGLAGIP 229

  Fly   138 IFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPW 202
            |||::..||||:|.|.:|.::..|..:|.|.|:|::::....||:|.....|.|...|:...:||
Zfish   230 IFLLEVSLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNIIMCWTLYYLFASLKETLPW 294

  Fly   203 MSCNNSWNTQEC 214
            .:|.|.|||.||
Zfish   295 ATCKNEWNTVEC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 35/92 (38%)
Cuticle_4 276..344 CDD:292577
slc6a5NP_001009557.1 SLC5-6-like_sbd 177..775 CDD:294310 46/139 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.