DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and blot

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524125.2 Gene:blot / 39939 FlyBaseID:FBgn0027660 Length:976 Species:Drosophila melanogaster


Alignment Length:97 Identity:24/97 - (24%)
Similarity:44/97 - (45%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLL 173
            ||..:|      ..:::.|::.:....||:.|::..:|||...|....:|.:|||||........
  Fly   241 ELDRYG------SAYLVPYVVLLFLVGLPMVLLEISVGQFLGQGAAHTWRASPIFKGACMISRFA 299

  Fly   174 NLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSC 205
            :..:..:.|:.||:.|.|........:|:..|
  Fly   300 SWLSAIWVSLQAVLALAYIGMFASNDLPFREC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 21/83 (25%)
Cuticle_4 276..344 CDD:464954
blotNP_524125.2 SLC5-6-like_sbd 219..659 CDD:271356 24/97 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.