DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and CG4476

DIOPT Version :10

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_648293.1 Gene:CG4476 / 39056 FlyBaseID:FBgn0035969 Length:629 Species:Drosophila melanogaster


Alignment Length:129 Identity:46/129 - (35%)
Similarity:61/129 - (47%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLG 146
            |.|..|..|.:| ..||......|.......|..|..|...|:|.||:.:.....||:.::..||
  Fly    49 KARDNWGSSLEF-LMSCIALSVGLGNVWRFPFTALENGGGAFLIPYLVVLFVVGKPIYYMEMLLG 112

  Fly   147 QFSSSGTISAFRVAPIFKGIGYAILLLNLGTL-TYYSIAAVVPLIYTVNSIHPVIPWMSCNNSW 209
            ||||.|.:..|..||:.:|:||| .||.||.| |||:....:.|.|..:|....:||..|...|
  Fly   113 QFSSRGIVQVFDFAPLMRGVGYA-QLLALGVLATYYASVMALTLRYFFDSFASELPWSFCREEW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:444915 35/88 (40%)
Cuticle_4 276..344 CDD:464954
CG4476NP_648293.1 SLC6sbd 52..526 CDD:271359 44/126 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.