DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and Slc6a16

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001311464.1 Gene:Slc6a16 / 381884 MGIID:2685930 Length:742 Species:Mus musculus


Alignment Length:395 Identity:77/395 - (19%)
Similarity:139/395 - (35%) Gaps:110/395 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SRQVHSMAVRTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTF--GILHGG 119
            |..|:.|:..:...|..          |..||...::..|..::.   |:.|.:..|  |.:|.|
Mouse   108 SELVNRMSRESSEGYPP----------RQLWASKVEYMLAIMSYL---LMPSGVLRFASGWVHKG 159

  Fly   120 WLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFR-VAPIFKGIGYAILLLNLGTLTYYSI 183
            ...|.|||::.:|...:|:..::..:||.:...:...:: ::|.|.|:||:::::...|.||.::
Mouse   160 SCSFFIAYILMLLGIGIPLLFLEMAVGQRAQQSSADMWKNLSPWFGGVGYSMVMVCFITNTYLNV 224

  Fly   184 AAVVPLIYTVNSIHPVIPWMSC----NNSWNTQECSLHENY-------------------DVDFA 225
            .....|.|..:..:.|:||..|    |:|....||....:|                   ...|:
Mouse   225 FNSWILFYMSHIFYFVVPWDQCPLQRNSSNFDPECEQATSYTYFWYRKTLKASDRIEDGGQPSFS 289

  Fly   226 VAVIFTLA-------LAMGVQS-------------SVI------PLLSQVAGHGLSYTAVSGPAV 264
            :.:...|:       |..|::|             |:|      .|....|.:||.:..:...|.
Mouse   290 LGMSLFLSFCLICAFLVNGIKSIGKVLFVLLLVPYSIIVCFLIRTLSMDGAEYGLKHLLILKVAS 354

  Fly   265 VASPWAVPAAHWPAAVNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPSV--VVAPVAHSGVYTAQ 327
            ::              ::..|..|.|.......|.......:|:|.|..  .:|......::...
Mouse   355 IS--------------DLTIWCHAGIQVLFDIGLGFGPIVSLASHVPDFNNCMADAFLMALFKII 405

  Fly   328 TRGAIHTAPLAGHIL---------HQCRSRTRNLVRSI----------PPSI---PLS-----IG 365
            |  .:.|.|....||         |.|:.....|:|.:          ||.:   |.|     :.
Mouse   406 T--LLMTTPFLLSILGFWATTTTHHCCKKNQETLLRLVAQGILPPDAQPPDLSGNPTSNYNSWLS 468

  Fly   366 PLPLP 370
            .||.|
Mouse   469 SLPPP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 33/163 (20%)
Cuticle_4 276..344 CDD:292577 13/78 (17%)
Slc6a16NP_001311464.1 SLC5-6-like_sbd 125..694 CDD:294310 73/368 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.