DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31904 and SerT

DIOPT Version :9

Sequence 1:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001369117.1 Gene:SerT / 37895 FlyBaseID:FBgn0010414 Length:768 Species:Drosophila melanogaster


Alignment Length:254 Identity:65/254 - (25%)
Similarity:105/254 - (41%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 DKCRGRWAKSADFYFASCTHA--------FSSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLP 137
            ::.|..|.:.|:|..|....|        |..:.:.        :||. .|::.|.:.::|..||
  Fly    71 ERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQ--------NGGG-AFLVPYCLFLIFGGLP 126

  Fly   138 IFLIQAFLGQFSSSGTISAF-RVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIP 201
            :|.::..||||...|.:|.: |:.|..||:||||.|:::....||:......:.|...|....:|
  Fly   127 LFYMELALGQFHRCGCLSIWKRICPALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLP 191

  Fly   202 WMSCNNSWNTQECS--LHENYDVDFAVAVIFTLALAMGVQSSVIPLLSQVAGHGLSYTAVSGPAV 264
            |.||:|.|||:.|.  ..||:.         .||.:...:.....:|....|:||.:.....|.:
  Fly   192 WTSCDNPWNTENCMQVTSENFT---------ELATSPAKEFFERKVLESYKGNGLDFMGPVKPTL 247

  Fly   265 VASPWAVPAAHWPAAVNVASWPPAAIHAAAPAVLAAPAPAVVAAHAPSVVVAPVAHSGV 323
            ....:.|     ...|..:.|  ..:.:|...|.       |.|.||.||:..:...||
  Fly   248 ALCVFGV-----FVLVYFSLW--KGVRSAGKVVW-------VTALAPYVVLIILLVRGV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 38/122 (31%)
Cuticle_4 276..344 CDD:292577 12/48 (25%)
SerTNP_001369117.1 SLC6sbd_SERT-like 74..607 CDD:271388 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.